Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS) , partial, Biotinylated

Product Specifications

CAS Number

9000-83-3

Gene Name

GLS

UniProt

O94925

Expression Region

616-669aa

Organism

Homo sapiens

Target Sequence

KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Field of Research

Signal Transduction

Assay Type

Developed Protein

Relevance

Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate, the main excitatory neurotransmitter in the brain. ; [Isoform 2]: Lacks catalytic activity.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-500 1x 500 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL
BNC740245-500 1x 500 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details