Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

Gp32; Helix-destabilizing protein

Abbreviation

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein

Gene Name

32

UniProt

P03695

Expression Region

1-301aa

Organism

Enterobacteria phage T4 (Bacteriophage T4)

Target Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds preferentially to single-stranded DNA and therefore, destabilizes double-stranded DNA. It is involved in DNA replication, repair and recombination. Binds ss-DNA as the replication fork advances and stimulates the replisome processivity and accuracy.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.5 kDa

References & Citations

"Crystal structure of a replication fork single-stranded DNA binding protein (T4 gp32) complexed to DNA." Shamoo Y., Friedman A.M., Parsons M.R., Konigsberg W.H., Steitz T.A. Nature 376:362-366 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 Rabbit Polyclonal Antibody
AP02642PU-N 100 µL

CDK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LARGE (LARGE1) Human Gene Knockout Kit (CRISPR)
KN217876LP 1 Kit

LARGE (LARGE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD57 Recombinant Mouse Monoclonal Antibody [PD00-21]
HA601114 100 µL

CD57 Recombinant Mouse Monoclonal Antibody [PD00-21]

Sign In for Pricing
View Details
Human ADAMTS12 activation kit by CRISPRa
GA113120 1 Kit

Human ADAMTS12 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM38B / PIEZO2 Recombinant Rabbit monoclonal Antibody
HA723342 100 µL

FAM38B / PIEZO2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PTP epsilon (PTPRE) (NM_006504) Human Recombinant Protein
TP307950 20 µg

PTP epsilon (PTPRE) (NM_006504) Human Recombinant Protein

Sign In for Pricing
View Details