Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Type VII secretion system extracellular protein C (esxC)

Product Specifications

Product Name Alternative

(Ess extracellular protein C)

Abbreviation

Recombinant Staphylococcus aureus esxC protein

Gene Name

EsxC

UniProt

P0C051

Expression Region

1-130aa

Organism

Staphylococcus aureus (strain Newman)

Target Sequence

MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAKDVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEKASEYFNKAMN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Required for persistent infection.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.4 kDa

References & Citations

"EsaC substrate for the ESAT-6 secretion pathway and its role in persistent infections of Staphylococcus aureus." Burts M.L., DeDent A.C., Missiakas D.M. Mol. Microbiol. 69:736-746 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-02 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-03 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-04 0.1 mg (Yeast)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-05 0.02 mg (Baculovirus)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)
MBS1070708-06 0.02 mg (Mammalian-Cell)

Recombinant Acinetobacter baumannii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details