Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AITRL/TNFSF18, Mouse

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR) . When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC) -activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1) [2]. AITRL/TNFSF18 Protein, Mouse is a recombinant mouse AITRL (T47-S173) without tag, which is expressed in E.coli.

Product Specifications

Product Name Alternative

AITRL/TNFSF18 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/aitrl-tnfsf18-protein-mouse.html

Purity

95.00

Smiles

TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS

Molecular Formula

240873 (Gene_ID) Q7TS55 (T47-S173) (Accession)

Molecular Weight

Approximately 14.5 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Park MS, et al. The association of the activation-inducible tumor necrosis factor receptor and ligand with lumbar disc herniation. Yonsei Med J. 2007 Oct 31;48 (5) :839-46.|[2]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[3]Lacal PM, et al. Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion. J Pharmacol Exp Ther. 2013 Oct;347 (1) :164-72.|[4]Wang F, et al. Structures of mouse and human GITR-GITRL complexes reveal unique TNF superfamily interactions. Nat Commun. 2021 Mar 2;12 (1) :1378.|[5]Placke T, et al. Glucocorticoid-induced TNFR-related (GITR) protein and its ligand in antitumor immunity: functional role and therapeutic modulation. Clin Dev Immunol. 2010;2010:239083.|[6]Tian J, et al. Increased GITRL Impairs the Function of Myeloid-Derived Suppressor Cells and Exacerbates Primary Sjögren Syndrome. J Immunol. 2019 Mar 15;202 (6) :1693-1703.|[7]Chen M, et al. IFN-β induces the proliferation of CD4+CD25+Foxp3+ regulatory T cells through upregulation of GITRL on dendritic cells in the treatment of multiple sclerosis. J Neuroimmunol. 2012 Jan 18;242 (1-2) :39-46.|[8]Nocentini G, et al. Pharmacological modulation of GITRL/GITR system: therapeutic perspectives. Br J Pharmacol. 2012 Apr;165 (7) :2089-99.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate
LC401966 20 µg

BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate

Sign In for Pricing
View Details
Psmc3ip Mouse Gene Knockout Kit (CRISPR)
KN514111 1 Kit

Psmc3ip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]
HA721649 100 µL

Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]

Sign In for Pricing
View Details
Acetyl L-Carnitine Hydrochloride
TRC-A171990-2.5G 2.5 g

Acetyl L-Carnitine Hydrochloride

Sign In for Pricing
View Details
Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein
TP313652M 100 µg

Epsin 2 (EPN2) (NM_014964) Human Recombinant Protein

Sign In for Pricing
View Details
(Z)-Fluoxastrobin
TRC-F596701-5MG 5 mg

(Z)-Fluoxastrobin

Sign In for Pricing
View Details