Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase

Product Specifications

Abbreviation

Recombinant Ustilaginoidea virens Phosphoacetylglucosamine mutase protein

UniProt

A0A063BTC5

Expression Region

1-538aa

Organism

Ustilaginoidea virens (Rice false smut fungus) (Villosiclava virens)

Target Sequence

MDEKILAASAKYPIVAGQRYRYGTAGFRMKADLLAGVSFRVGLLAGLRSRKLNGQAIGVMITASHNPAADNGIKIVDPMGEMLEQEWESYATRLVNCRTDQELLDTYKAMATQLKVDMHTSGRVIYGRDTRPSGHSLVCALAAALDATDTNHTDYKILTTPQLHYLTRCVNTEGTPKAYGEASEVGYYEKFADAFVRALRGKKIRGQLIVDCANGVGGPKLSEMLKFIPKHVSGFDVRLVNDDVLRPEVLNLDCGADFVKTKQRAPLSPKPVPGVRCCSFDGDADRLIYYWVDPEMGFVMLDGDRISSLCASFIGDLVRSAGLADELRIGVVQTAYANGASTTYIERHLQLPVVFTNTGVKHLHHAACQFDVGVYFEANGHGTVVFSQEAMRAFVEKEPQSPAQKAALETLAAVGDLVNQTVGDAISDMLMVEVVLAHKDWTLKDWAMTYTDRPNRLVRVEVGNKHLFQATDAERRLSHPPGAQDEIDQVVQKYTTARSFARASGTENACRVYAEAATRSEADELANKVAQIVKQFGS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
BNC940806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details