Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-SARS-CoV-2 NSP9 Antibody (Biotine Conjugate)

Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human.

Product Specifications

Background

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Synonyms

Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp9; Non-structural protein 9

Gene Name

Non-structural protein 9

UniProt

P0DTC1/P0DTD1

Host

Rabbit

Reactivity

Human

Immunogen

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Clonality

Polyclonal

Tissue Specificity

Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .

Applications

ELISA

Purification

Immunogen affinity purified.

Concentration

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Form

Lyophilized

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Function

Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.

Storage Conditions

Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Fragment

Rabbit IgG

Applications Notes

ELISA, 0.001-0.1μg/ml, Human

Subcellular Location

Cytoplasm .

Protein Name

Synapsin-1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pi4k2a shRNA (UAS) - Lentiviral mouse Pi4k2a shRNA (UAS, GFP) (100)
GTR15177141 1 Vial

Lentiviral mouse Pi4k2a shRNA (UAS) - Lentiviral mouse Pi4k2a shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
AMD1 293 Cell Lysate
409288 0.1 mg

AMD1 293 Cell Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal BRCA1 Antibody [FITC]
NB100-199F 0.1 mL

Rabbit Polyclonal BRCA1 Antibody [FITC]

Sign In for Pricing
View Details
Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit
MBS9716099-01 48 Tests

Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit

Sign In for Pricing
View Details
Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit
MBS9716099-02 96 Tests

Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit

Sign In for Pricing
View Details
Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit
MBS9716099-03 5x 96 Tests

Human Aspartyl/asparaginyl beta-Hydroxylase (ASPH) ELISA Kit

Sign In for Pricing
View Details