Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2CR4 Peptide - middle region

ALS2CR4 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp313L091, FLJ33282, JBTS14, ALS2CR4

UniProt

Q96Q45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2CR4 Rabbit Polyclonal Antibody (orb579350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001037850

Preservative

Lyophilized powder

AA Sequence

AGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS4 (C-term) Rabbit Polyclonal Antibody
AP17586PU-N 400 µL

NDUFS4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tiafenacil Metabolite M-36
TRC-T436330-5MG 5 mg

Tiafenacil Metabolite M-36

Sign In for Pricing
View Details
Recombinant COL6A1 Antibody
RC-4727-01 50 μL

Recombinant COL6A1 Antibody

Sign In for Pricing
View Details
Recombinant COL6A1 Antibody
RC-4727-02 100 µL

Recombinant COL6A1 Antibody

Sign In for Pricing
View Details
Recombinant COL6A1 Antibody
RC-4727-03 1 mL

Recombinant COL6A1 Antibody

Sign In for Pricing
View Details
PRMT4 (CARM1) Rabbit Polyclonal Antibody
TA366826 100 µL

PRMT4 (CARM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details