Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALS2CR4 Peptide - middle region

ALS2CR4 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp313L091, FLJ33282, JBTS14, ALS2CR4

UniProt

Q96Q45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALS2CR4 Rabbit Polyclonal Antibody (orb579350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001037850

Preservative

Lyophilized powder

AA Sequence

AGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrillin-1 Antibody
8C0194-AAT 50 µg

Fibrillin-1 Antibody

Sign In for Pricing
View Details
COASY (NM_001042530) Human Over-expression Lysate
LC420964 20 µg

COASY (NM_001042530) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD49d Antibody[R1-2]
AN00422E-01 50 Tests

APC Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
APC Anti-Mouse CD49d Antibody[R1-2]
AN00422E-02 100 Tests

APC Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
APC Anti-Mouse CD49d Antibody[R1-2]
AN00422E-03 2x 100 Tests

APC Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
TWEAKR (TNFRSF12A) Human Gene Knockout Kit (CRISPR)
KN201041LP 1 Kit

TWEAKR (TNFRSF12A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details