Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLS1 Peptide - middle region

CRLS1 Peptide - middle region

Product Specifications

Product Name Alternative

C20orf155, CLS1, GCD10, dJ967N21.6, CLS

UniProt

Q9UJA2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRLS1 Rabbit Polyclonal Antibody (orb580737) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061968

Preservative

Lyophilized powder

AA Sequence

WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT9B (NM_003396) Human Over-expression Lysate
LY401159 100 µg

WNT9B (NM_003396) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-01 20 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-02 60 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-03 120 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFS1 Polyclonal Antibody
E-AB-11432-04 200 µL

NDUFS1 Polyclonal Antibody

Sign In for Pricing
View Details
TCF7L2 (NM_001198525) Human Over-expression Lysate
LY434261 100 µg

TCF7L2 (NM_001198525) Human Over-expression Lysate

Sign In for Pricing
View Details