Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D4S234E Peptide - N-terminal region

D4S234E Peptide - N-terminal region

Product Specifications

Product Name Alternative

D4S234, NEEP21, NSG1, P21, D4S234E

UniProt

P42857

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D4S234E Rabbit Polyclonal Antibody (orb579340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035190

Preservative

Lyophilized powder

AA Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement factor 8 beta Rabbit Polyclonal Antibody (AP)
orb939257 100 µL

Complement factor 8 beta Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Tousled-like kinase 1
337606 100 µL

Tousled-like kinase 1

Sign In for Pricing
View Details
H3 (pS10) Antibody
abx025104-01 80 µL

H3 (pS10) Antibody

Sign In for Pricing
View Details
H3 (pS10) Antibody
abx025104-02 400 µL

H3 (pS10) Antibody

Sign In for Pricing
View Details
Lentiviral mouse 2310030G06Rik shRNA (UAS) - Lentiviral mouse 2310030G06Rik shRNA (UAS, RFP) plasmid
GTR15214621 1 Vial

Lentiviral mouse 2310030G06Rik shRNA (UAS) - Lentiviral mouse 2310030G06Rik shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Cytokine Like Protein 1 (CYTL1) ELISA Kit
YP-W39019-01 48 Tests

Rat Cytokine Like Protein 1 (CYTL1) ELISA Kit

Sign In for Pricing
View Details