Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D4S234E Peptide - N-terminal region

D4S234E Peptide - N-terminal region

Product Specifications

Product Name Alternative

D4S234, NEEP21, NSG1, P21, D4S234E

UniProt

P42857

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D4S234E Rabbit Polyclonal Antibody (orb579340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035190

Preservative

Lyophilized powder

AA Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC)
MBS6167682-01 0.1 mL

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC)

Sign In for Pricing
View Details
MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC)
MBS6167682-02 5x 0.1 mL

MCM3 (Minichromosome Maintenance Complex Component 3, HCC5, MGC1157, P1-MCM3, P1.h, RLFB) (APC)

Sign In for Pricing
View Details
Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase)
043401 200 µL

Tssk6, CT (Tssk6, Sstk, Testis-specific serine/threonine-protein kinase 6, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase)

Sign In for Pricing
View Details
Nitrite Microplate Assay Kit
MBS8309615-01 100 Assays

Nitrite Microplate Assay Kit

Sign In for Pricing
View Details
Nitrite Microplate Assay Kit
MBS8309615-02 5x 100 Assays

Nitrite Microplate Assay Kit

Sign In for Pricing
View Details
Glrx3 Mouse qPCR Template Standard (NM_023140)
MK202607 1 Kit

Glrx3 Mouse qPCR Template Standard (NM_023140)

Sign In for Pricing
View Details