Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM5 Peptide - middle region

IFITM5 Peptide - middle region

Product Specifications

Product Name Alternative

Hrmp1, fragilis4, BRIL

UniProt

A6NNB3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFITM5 Rabbit Polyclonal Antibody (orb579279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020466

Preservative

Lyophilized powder

AA Sequence

AKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-6905-3p miRNA Inhibitor
MIM02553 2x 5.0 nmol

mmu-miR-6905-3p miRNA Inhibitor

Sign In for Pricing
View Details
4933405O20Rik Mouse qPCR Primer Pair (NM_172901)
MP213993 200 Reactions

4933405O20Rik Mouse qPCR Primer Pair (NM_172901)

Sign In for Pricing
View Details
HNRPLL (HNRNPLL) (NM_138394) Human Recombinant Protein
TP303569L 1 mg

HNRPLL (HNRNPLL) (NM_138394) Human Recombinant Protein

Sign In for Pricing
View Details
Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF740 conjugate, 0.1mg/mL
BNC742891-100 1x 100 µL

Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lilrb3l (NM_001037357) Rat Tagged Lenti ORF Clone
RR213401L3 10 µg

Lilrb3l (NM_001037357) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Kinesis Syringe Microvolume 10ul FN FP 26G Bevel - EACH
CHR1462 1 Each

Kinesis Syringe Microvolume 10ul FN FP 26G Bevel - EACH

Sign In for Pricing
View Details