Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM5 Peptide - middle region

IFITM5 Peptide - middle region

Product Specifications

Product Name Alternative

Hrmp1, fragilis4, BRIL

UniProt

A6NNB3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFITM5 Rabbit Polyclonal Antibody (orb579279) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020466

Preservative

Lyophilized powder

AA Sequence

AKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM CRISPR/Cas9 KO Plasmid (m)
sc-423380 20 µg

TM CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Msh4 3'UTR GFP Stable Cell Line
TU163516 1.0 mL

Msh4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Peroxin 26 CRISPR Activation Plasmid (h)
sc-408486-ACT 20 µg

Peroxin 26 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Wfdc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3666205 3x 1.0 µg

Wfdc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Beta-Nerve Growth Factor (NGF) Antibody
abx170394-01 100 µL

Beta-Nerve Growth Factor (NGF) Antibody

Sign In for Pricing
View Details
Beta-Nerve Growth Factor (NGF) Antibody
abx170394-02 200 µL

Beta-Nerve Growth Factor (NGF) Antibody

Sign In for Pricing
View Details