Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf11 Peptide - middle region

Klf11 Peptide - middle region

Product Specifications

Product Name Alternative

9830142A17, D12Ertd427e, Tieg2, Tieg2b, Tieg3

UniProt

Q8K1S5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klf11 Rabbit Polyclonal Antibody (orb576344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848134

Preservative

Lyophilized powder

AA Sequence

PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper(II) Chloride
TRC-C685305-5G 5 g

Copper(II) Chloride

Sign In for Pricing
View Details
ACOX3 Antibody (FITC)
orb20704-01 50 µg

ACOX3 Antibody (FITC)

Sign In for Pricing
View Details
ACOX3 Antibody (FITC)
orb20704-02 100 µg

ACOX3 Antibody (FITC)

Sign In for Pricing
View Details
GALK2 siRNA (h)
sc-90002 10 µM

GALK2 siRNA (h)

Sign In for Pricing
View Details
Anti-AICDA Rabbit pAb
GB112019-50 50 μL

Anti-AICDA Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human DLG4/PSD95 Protein, N-His
YHF65301 100 μg

Recombinant Human DLG4/PSD95 Protein, N-His

Sign In for Pricing
View Details