Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC546094 Peptide - C-terminal region

LOC546094 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_622443

Preservative

Lyophilized powder

AA Sequence

PQCPSEFFMECRISDGQNTLDILNTENFIFSTSIEKIVAKKNSIRVHLGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL
BNC471870-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF740 conjugate, 0.1mg/mL
BNC741796-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details