Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafa Peptide - middle region

Mafa Peptide - middle region

Product Specifications

Product Name Alternative

RIPE3b1

UniProt

Q8CF90

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mafa Rabbit Polyclonal Antibody (orb576358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919331

Preservative

Lyophilized powder

AA Sequence

GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANTES Rabbit Polyclonal Antibody (FITC)
orb360851 100 µg

RANTES Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
pCMV-SPORT6-FAM131C Plasmid
PVT16433 2 µg

pCMV-SPORT6-FAM131C Plasmid

Sign In for Pricing
View Details
Human diamine oxidase (DAO) ELISA Kit
201-12-0777 96 Tests

Human diamine oxidase (DAO) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal ASRGL1 Antibody (CRASH/1290) [DyLight 405]
NBP3-08327V 100 µL

Mouse Monoclonal ASRGL1 Antibody (CRASH/1290) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Human Valacyclovir hydrolase (BPHL)
RPC30735-01 20 µg

Recombinant Human Valacyclovir hydrolase (BPHL)

Sign In for Pricing
View Details
Recombinant Human Valacyclovir hydrolase (BPHL)
RPC30735-02 100 µg

Recombinant Human Valacyclovir hydrolase (BPHL)

Sign In for Pricing
View Details