Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafa Peptide - middle region

Mafa Peptide - middle region

Product Specifications

Product Name Alternative

RIPE3b1

UniProt

Q8CF90

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mafa Rabbit Polyclonal Antibody (orb576358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919331

Preservative

Lyophilized powder

AA Sequence

GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromoisophthalic acid
435853-01 100 mg

5-Bromoisophthalic acid

Sign In for Pricing
View Details
5-Bromoisophthalic acid
435853-02 250 mg

5-Bromoisophthalic acid

Sign In for Pricing
View Details
FGF22 Rabbit Polyclonal Antibody
orb100674-01 50 μL

FGF22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF22 Rabbit Polyclonal Antibody
orb100674-02 100 µL

FGF22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF22 Rabbit Polyclonal Antibody
orb100674-03 200 µL

FGF22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SERPINI2 (NM_006217) Human Over-expression Lysate
LS005276-20ug 20 µg

SERPINI2 (NM_006217) Human Over-expression Lysate

Sign In for Pricing
View Details