Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR6A1 Peptide - middle region

NR6A1 Peptide - middle region

Product Specifications

Product Name Alternative

GCNF, GCNF1, NR61, RTR

UniProt

Q15406

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR6A1 Rabbit Polyclonal Antibody (orb579529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001480

Preservative

Lyophilized powder

AA Sequence

ILLSSLTVYSKQIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGEF1B Protein Vector (Mouse) (pPM-C-His)
PV222541 500 ng

RASGEF1B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-MSK1 (S376) recombinant monoclonal antibody
A5328 100ul X 3

Phospho-MSK1 (S376) recombinant monoclonal antibody

Sign In for Pricing
View Details
Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit
MBS7235757-01 48 Well

Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit

Sign In for Pricing
View Details
Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit
MBS7235757-02 96 Well

Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit

Sign In for Pricing
View Details
Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit
MBS7235757-03 5x 96 Well

Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit

Sign In for Pricing
View Details
Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit
MBS7235757-04 10x 96 Well

Bovine Spermatid perinuclear RNA-binding protein (STRBP) ELISA Kit

Sign In for Pricing
View Details