Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH18 Peptide - N-terminal region

PCDH18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZP434B0923, KIAA1562, PCDH68L

UniProt

Q9HCL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDH18 Rabbit Polyclonal Antibody (orb580729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061908

Preservative

Lyophilized powder

AA Sequence

MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP126 Rabbit Polyclonal Antibody (Biotin)
orb448078 100 µL

MAP126 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human ITGB1 (C-6His)
C906-01 10 µg

Recombinant Human ITGB1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ITGB1 (C-6His)
C906-02 50 µg

Recombinant Human ITGB1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ITGB1 (C-6His)
C906-03 500 µg

Recombinant Human ITGB1 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ITGB1 (C-6His)
C906-04 1 mg

Recombinant Human ITGB1 (C-6His)

Sign In for Pricing
View Details
Strain Anka PBANKA_1012900 Antibody APC Conjugated
orb3157915 200 µL

Strain Anka PBANKA_1012900 Antibody APC Conjugated

Sign In for Pricing
View Details