Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH18 Peptide - N-terminal region

PCDH18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZP434B0923, KIAA1562, PCDH68L

UniProt

Q9HCL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCDH18 Rabbit Polyclonal Antibody (orb580729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061908

Preservative

Lyophilized powder

AA Sequence

MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)
MBS9511465-01 3 mL (RTU)

Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)
MBS9511465-02 6 mL (RTU)

Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)
MBS9511465-03 12 mL (RTU)

Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)
MBS9511465-04 5x 12 mL (RTU)

Anti-Human Galectin 3 (ABT-GAL3) Mouse Monoclonal Antibody (Ready to Use)

Sign In for Pricing
View Details
Monkey Apoprotein B100 ELISA Kit
GTR10479348-01 48 Well

Monkey Apoprotein B100 ELISA Kit

Sign In for Pricing
View Details
Monkey Apoprotein B100 ELISA Kit
GTR10479348-02 96 Well

Monkey Apoprotein B100 ELISA Kit

Sign In for Pricing
View Details