Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 Peptide - N-terminal region

Pias2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6330408K17Rik, AI462206, ARIP3, AU018068, Dib, Miz1, PIASxalpha, PIASxb, PIASxbeta, SIZ2

UniProt

Q8C5D8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pias2 Rabbit Polyclonal Antibody (orb329941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032628

Preservative

Lyophilized powder

AA Sequence

SVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGSVLLQDTKPTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46318111 3x 1.0 µg

TCAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CHO Monoclonal IL-6R alpha Antibody (vobarilizumab) [mFluor Violet 500 SE]
NBP3-28014MFV500 0.1 mL

CHO Monoclonal IL-6R alpha Antibody (vobarilizumab) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
FAM3C Protein Lysate
OCOA10905-20UG 20 µg

FAM3C Protein Lysate

Sign In for Pricing
View Details
Ethyl thioglycolate
OR17516 5 g

Ethyl thioglycolate

Sign In for Pricing
View Details
R MKP3 Antibody Blocking peptide
orb1443616 500 µg

R MKP3 Antibody Blocking peptide

Sign In for Pricing
View Details
DDX11L5 Adenovirus (Human)
17803051 1.0 mL

DDX11L5 Adenovirus (Human)

Sign In for Pricing
View Details