Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 Peptide - N-terminal region

Pias2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6330408K17Rik, AI462206, ARIP3, AU018068, Dib, Miz1, PIASxalpha, PIASxb, PIASxbeta, SIZ2

UniProt

Q8C5D8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pias2 Rabbit Polyclonal Antibody (orb329941) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032628

Preservative

Lyophilized powder

AA Sequence

SVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGSVLLQDTKPTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syntabulin (SYBU) ELISA Kit
MBS9311962-01 48 Well

Human Syntabulin (SYBU) ELISA Kit

Sign In for Pricing
View Details
Human Syntabulin (SYBU) ELISA Kit
MBS9311962-02 96 Well

Human Syntabulin (SYBU) ELISA Kit

Sign In for Pricing
View Details
Human Syntabulin (SYBU) ELISA Kit
MBS9311962-03 5x 96 Well

Human Syntabulin (SYBU) ELISA Kit

Sign In for Pricing
View Details
Human Syntabulin (SYBU) ELISA Kit
MBS9311962-04 10x 96 Well

Human Syntabulin (SYBU) ELISA Kit

Sign In for Pricing
View Details
Zc3h7a (NM_145931) Mouse Tagged Lenti ORF Clone
MR211014L3 10 µg

Zc3h7a (NM_145931) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Comb for 8 samples, multichannel, 0.75 mm thick
SPMN8MC-0.75 1 Unit

Comb for 8 samples, multichannel, 0.75 mm thick

Sign In for Pricing
View Details