Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGA Peptide - middle region

PIGA Peptide - middle region

Product Specifications

Product Name Alternative

GPI3, PIG-A

UniProt

P37287

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGA Rabbit Polyclonal Antibody (orb579439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002632

Preservative

Lyophilized powder

AA Sequence

NHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMED2 Pre-designed siRNA Set B
SI016766B 1 Each

Human TMED2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Fbxo25 3'UTR Luciferase Stable Cell Line
TU204504 1.0 mL

Fbxo25 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat
156141-01 10 µg

Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat

Sign In for Pricing
View Details
Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat
156141-02 50 µg

Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat

Sign In for Pricing
View Details
Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat
156141-03 200 µg

Non Metastatic Cells 6, Protein Expressed In (NME6) Recombinant, Rat

Sign In for Pricing
View Details
Lentiviral mouse Sft2d2 shRNA (UAS) - Lentiviral mouse Sft2d2 shRNA (UAS, RFP) plasmid
GTR15198481 1 Vial

Lentiviral mouse Sft2d2 shRNA (UAS) - Lentiviral mouse Sft2d2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details