Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGA Peptide - middle region

PIGA Peptide - middle region

Product Specifications

Product Name Alternative

GPI3, PIG-A

UniProt

P37287

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIGA Rabbit Polyclonal Antibody (orb579439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002632

Preservative

Lyophilized powder

AA Sequence

NHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN10 Antibody
CSB-PA006779-01 50 µg

CAPN10 Antibody

Sign In for Pricing
View Details
CAPN10 Antibody
CSB-PA006779-02 100 µg

CAPN10 Antibody

Sign In for Pricing
View Details
Phospho-CDK2 (Thr14) Recombinant Rabbit mAb
ARM3041-01 30 µL

Phospho-CDK2 (Thr14) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-CDK2 (Thr14) Recombinant Rabbit mAb
ARM3041-02 50 μL

Phospho-CDK2 (Thr14) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Phospho-CDK2 (Thr14) Recombinant Rabbit mAb
ARM3041-03 100 µL

Phospho-CDK2 (Thr14) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi YbbR-like domain-containing protein BB_0009 (BB_0009)
MBS7036780-01 0.02 mg

Recombinant Borrelia burgdorferi YbbR-like domain-containing protein BB_0009 (BB_0009)

Sign In for Pricing
View Details