Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Peptide - middle region

Prrx2 Peptide - middle region

Product Specifications

Product Name Alternative

Prx2, S8

UniProt

Q06348

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrx2 Rabbit Polyclonal Antibody (orb576450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033142

Preservative

Lyophilized powder

AA Sequence

AKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMSPDYLSWPASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mttp-set siRNA/shRNA/RNAi Lentivector (Mouse)
31117094 4x 500 ng

Mttp-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Sodium lauroylsarcosinate
JH629753 1 Each

Sodium lauroylsarcosinate

Sign In for Pricing
View Details
Recombinant PSMD14 Rabbit mAb
E38MA4690 100 µL

Recombinant PSMD14 Rabbit mAb

Sign In for Pricing
View Details
GAPDH
E8ET1601-4 100 µL

GAPDH

Sign In for Pricing
View Details
TAF11 (NM_005643) Human 3' UTR Clone
SC210727 10 µg

TAF11 (NM_005643) Human 3' UTR Clone

Sign In for Pricing
View Details
Recombinant Feline Leukemia Virus Gag-Pol Polyprotein (pol)
VG2C136-01 1 mg

Recombinant Feline Leukemia Virus Gag-Pol Polyprotein (pol)

Sign In for Pricing
View Details