Prrxl1 Peptide - C-terminal region
Prrxl1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Drg11, Drgx
UniProt
Q8BYH0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001796
Preservative
Lyophilized powder
AA Sequence
PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472115-100 1x 100 µL
Cytokeratin 8 (KRT8) (KRT8/2115), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-EL-M0795-01 24 Tests
Mouse MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details E-EL-M0795-02 48 Tests
Mouse MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details E-EL-M0795-03 96 Tests
Mouse MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details