Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Peptide - C-terminal region

Prrxl1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Drg11, Drgx

UniProt

Q8BYH0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prrxl1 Rabbit Polyclonal Antibody (orb324744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001796

Preservative

Lyophilized powder

AA Sequence

PSCLPGTLLNTATYAQALSHVASLKDHFRAMLCSGSFGFRGEQTQQRALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rel B (RELB) Human Gene Knockout Kit (CRISPR)
KN207006RB 1 Kit

Rel B (RELB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Cystatin 7/CST7 Protein
PKSH031811 20 µg

Recombinant Human Cystatin 7/CST7 Protein

Sign In for Pricing
View Details
IBTK Human Gene Knockout Kit (CRISPR)
KN418657 1 Kit

IBTK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), CF647 conjugate, 0.1mg/mL
BNC473156-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Qsox1 Mouse Gene Knockout Kit (CRISPR)
KN514312 1 Kit

Qsox1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Bromopropionic Acid
TRC-B687705-50G 50 g

3-Bromopropionic Acid

Sign In for Pricing
View Details