Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pus1 Peptide - N-terminal region

Pus1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A730013B20Rik, MPUS1, mPus1p

UniProt

Q9WU56

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pus1 Rabbit Polyclonal Antibody (orb576259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020733

Preservative

Lyophilized powder

AA Sequence

GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aminoacylase 1 (ACY1) Human Gene Knockout Kit (CRISPR)
KN401284 1 Kit

Aminoacylase 1 (ACY1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Progesterone Receptor (Ab-294) Antibody
8B0558-AAT 50 µg

Progesterone Receptor (Ab-294) Antibody

Sign In for Pricing
View Details
Melanoma Marker (KBA.62), 0.2mg/mL
BNUB0895-500 1x 500 µL

Melanoma Marker (KBA.62), 0.2mg/mL

Sign In for Pricing
View Details
Ripk3 Mouse Gene Knockout Kit (CRISPR)
KN514842 1 Kit

Ripk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]
TA801325AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]

Sign In for Pricing
View Details
PPOX (NM_000309) Human Over-expression Lysate
LC424808 20 µg

PPOX (NM_000309) Human Over-expression Lysate

Sign In for Pricing
View Details