Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDK1 Peptide - middle region

SDK1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ31425

UniProt

Q7Z5N4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001073121

Preservative

Lyophilized powder

AA Sequence

AVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Human NAP (Neutrophil Alkaline Phosphatase)
E-EL-H2301 96 Tests

ELISA kit for Human NAP (Neutrophil Alkaline Phosphatase)

Sign In for Pricing
View Details
Recombinant Human Legumain (LGMN)
CSB-YP012903HU-01 20 µg

Recombinant Human Legumain (LGMN)

Sign In for Pricing
View Details
Recombinant Human Legumain (LGMN)
CSB-YP012903HU-02 100 µg

Recombinant Human Legumain (LGMN)

Sign In for Pricing
View Details
Recombinant Human Legumain (LGMN)
CSB-YP012903HU-03 1 mg

Recombinant Human Legumain (LGMN)

Sign In for Pricing
View Details
Human Aggrecan/ACAN ELISA Kit
orb315093 96 Tests

Human Aggrecan/ACAN ELISA Kit

Sign In for Pricing
View Details
CYTIP (Cytohesin Interacting Protein) BioAssayTM ELISA Kit (Human) discontinued
382622 96 Tests

CYTIP (Cytohesin Interacting Protein) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details