Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC10A3 Peptide - middle region

SLC10A3 Peptide - middle region

Product Specifications

Product Name Alternative

DXS253E, P3

UniProt

P09131

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC10A3 Rabbit Polyclonal Antibody (orb580742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062822

Preservative

Lyophilized powder

AA Sequence

MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A2 Rabbit pAb, AP conjugated
orb2891950 100 µL

EEF1A2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Human Cystatin C
7-04938 1 mg

Human Cystatin C

Sign In for Pricing
View Details
Cwc22 Mouse shRNA Plasmid (Locus ID 80744)
TL505350 1 Kit

Cwc22 Mouse shRNA Plasmid (Locus ID 80744)

Sign In for Pricing
View Details
JUN (16R18) Mouse Monoclonal antibody
E28PE1407 100 µL

JUN (16R18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Recombinant Borrelia Afzelii pstB Protein (aa 1-260)
VAng-Lsx1672-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Afzelii pstB Protein (aa 1-260)

Sign In for Pricing
View Details
PA1 (PAGR1) (NM_024516) Human Recombinant Protein
E45H41437M5 20 µg

PA1 (PAGR1) (NM_024516) Human Recombinant Protein

Sign In for Pricing
View Details