SLC10A3 Peptide - middle region
SLC10A3 Peptide - middle region
Product Specifications
Product Name Alternative
DXS253E, P3
UniProt
P09131
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC10A3 Rabbit Polyclonal Antibody (orb580742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062822
Preservative
Lyophilized powder
AA Sequence
MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6239067-01 0.1 mL
KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (MaxLight 750)
Sign In for Pricing
View Details 
MBS6239067-02 5x 0.1 mL
KIAA2002 (NKF3 Kinase Family Member, FLJ21140, FLJ34483, KIAA2002) (MaxLight 750)
Sign In for Pricing
View Details 226096-01 50 µL
STEAP3 (1010001D01Rik, Dudlin 2, Dudlin2, Dudulin 2, Dudulin-2, Dudulin2, hpHyde, hTSAP6, Metalloreductase STEAP3, MGC93147, pHyde, Six Transmembrane epithelial Antigen of Prostate 3, Six Transmembrane Prostate Protein 3, Six-Transmembrane epithelial Antigen of Prostate 3, STEA 3, STEA3, STEAP 3, STEAP Family Member 3, STEAP Family Member 3 metalloreductase, STEAP3, STMP 3, STMP3, TSAP 6, TSAP6, Tumor Suppressor Activated pathway Protein 6, Tumor Suppressor pHyde, Tumor s) discontinued
Sign In for Pricing
View Details 
226096-02 100 µL
STEAP3 (1010001D01Rik, Dudlin 2, Dudlin2, Dudulin 2, Dudulin-2, Dudulin2, hpHyde, hTSAP6, Metalloreductase STEAP3, MGC93147, pHyde, Six Transmembrane epithelial Antigen of Prostate 3, Six Transmembrane Prostate Protein 3, Six-Transmembrane epithelial Antigen of Prostate 3, STEA 3, STEA3, STEAP 3, STEAP Family Member 3, STEAP Family Member 3 metalloreductase, STEAP3, STMP 3, STMP3, TSAP 6, TSAP6, Tumor Suppressor Activated pathway Protein 6, Tumor Suppressor pHyde, Tumor s) discontinued
Sign In for Pricing
View Details