SLC25A48 Peptide - C-terminal region
SLC25A48 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HDMCP
UniProt
Q6ZT89
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC25A48 Rabbit Polyclonal Antibody (orb581857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
BAC86705
Preservative
Lyophilized powder
AA Sequence
TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY423034 100 µg
TMEM225 (NM_001013743) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC882717-500 1x 500 µL
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSV030189 100 µg
Recombinant HIV-1 gp140 Protein (group P, strain RBF168) (Fc Tag)
Sign In for Pricing
View Details 
R-2701-2 2 mg
TRITC Conjugated Pisum sativum Lectin (Garden Pea) -PEAPSA-
Sign In for Pricing
View Details 
LC426341 20 µg
Tartrate Resistant Acid Phosphatase (ACP5) (NM_001111035) Human Over-expression Lysate
Sign In for Pricing
View Details