Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A48 Peptide - C-terminal region

SLC25A48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HDMCP

UniProt

Q6ZT89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A48 Rabbit Polyclonal Antibody (orb581857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAC86705

Preservative

Lyophilized powder

AA Sequence

TAVGQLGNCHALLSPGGGQDTFRYSPNNSLLGTYSVPGPLPPQSHPFPMQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA501418AM 100 µL

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Human KIAA1109 activation kit by CRISPRa
GA113399 1 Kit

Human KIAA1109 activation kit by CRISPRa

Sign In for Pricing
View Details
ARPC1A (Center) Rabbit Polyclonal Antibody
AP17130PU-N 400 µL

ARPC1A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS641390 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
5-Chloro-4-(3-pyridinyl)-2-pyrimidinamine
TRC-C376016-500MG 500 mg

5-Chloro-4-(3-pyridinyl)-2-pyrimidinamine

Sign In for Pricing
View Details
TNF alpha (TNF656), CF647 conjugate, 0.1mg/mL
BNC470656-100 1x 100 µL

TNF alpha (TNF656), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details