Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35A4 Peptide - middle region

SLC35A4 Peptide - middle region

Product Specifications

Product Name Alternative

MGC2541

UniProt

Q96G79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35A4 Rabbit Polyclonal Antibody (orb579048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542401

Preservative

Lyophilized powder

AA Sequence

GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PEBP1 Protein
E30P1692 20 µg

Recombinant Human PEBP1 Protein

Sign In for Pricing
View Details
IL5RA Recombinant Antibody, PE-Cy5 Conjugated
bsm-62790R-PE-Cy5 100 µL

IL5RA Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Heartland Virus Glycoprotein 1 Antibody [Alexa Fluor 488]
NBP2-41228AF488 0.1 mL

Rabbit Polyclonal Heartland Virus Glycoprotein 1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)
HY-P80451-01 10 µL

Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)
HY-P80451-02 50 μL

Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)
HY-P80451-03 100 µL

Phospho-AMPK alpha 1 (Ser496) Antibody (YA226, Rabbit)

Sign In for Pricing
View Details