Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLCO1A2 Peptide - middle region

SLCO1A2 Peptide - middle region

Product Specifications

Product Name Alternative

OATP, OATP-A, OATP1A2, SLC21A3

UniProt

P46721

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLCO1A2 Rabbit Polyclonal Antibody (orb330350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

AAD52694

Preservative

Lyophilized powder

AA Sequence

VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7206907-01 48 Well

Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7206907-02 96 Well

Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7206907-03 5x 96 Well

Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7206907-04 10x 96 Well

Chicken Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Apolipoprotein L 1 Antibody
orb1326852 100 µg

Apolipoprotein L 1 Antibody

Sign In for Pricing
View Details
Pregnancy (hCG) Enhanced Sensitivity Rapid Test Midstream
FHC-U103H 1 Test

Pregnancy (hCG) Enhanced Sensitivity Rapid Test Midstream

Sign In for Pricing
View Details