Sohlh1 Peptide - middle region
Sohlh1 Peptide - middle region
Product Specifications
Product Name Alternative
Gm110, Nohlh, RP23-123F7.2
UniProt
Q6IUP1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sohlh1 Rabbit Polyclonal Antibody (orb576443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001714
Preservative
Lyophilized powder
AA Sequence
PQEMWHMWQGDVLQVTLANQIADSKPDSGIAKPSAVSRVQDPPCFGMLDT
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx008718-01 30 µL
Src Homology 2 Domain Containing Adapter Protein B (SHB) Antibody
Sign In for Pricing
View Details abx008718-02 100 µL
Src Homology 2 Domain Containing Adapter Protein B (SHB) Antibody
Sign In for Pricing
View Details abx008718-03 200 µL
Src Homology 2 Domain Containing Adapter Protein B (SHB) Antibody
Sign In for Pricing
View Details 