Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sohlh1 Peptide - middle region

Sohlh1 Peptide - middle region

Product Specifications

Product Name Alternative

Gm110, Nohlh, RP23-123F7.2

UniProt

Q6IUP1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sohlh1 Rabbit Polyclonal Antibody (orb576443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001714

Preservative

Lyophilized powder

AA Sequence

PQEMWHMWQGDVLQVTLANQIADSKPDSGIAKPSAVSRVQDPPCFGMLDT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMI, NT (NMI, N-myc-interactor, N-myc and STAT interactor) (AP)
MBS6325851-01 0.2 mL

NMI, NT (NMI, N-myc-interactor, N-myc and STAT interactor) (AP)

Sign In for Pricing
View Details
NMI, NT (NMI, N-myc-interactor, N-myc and STAT interactor) (AP)
MBS6325851-02 5x 0.2 mL

NMI, NT (NMI, N-myc-interactor, N-myc and STAT interactor) (AP)

Sign In for Pricing
View Details
18-Azido-stearic acid
T89776-01 10 mg

18-Azido-stearic acid

Sign In for Pricing
View Details
18-Azido-stearic acid
T89776-02 50 mg

18-Azido-stearic acid

Sign In for Pricing
View Details
1,3-Bis(2-propen-1-ylamino)-2-propanol
TRC-P768828-500MG 500 mg

1,3-Bis(2-propen-1-ylamino)-2-propanol

Sign In for Pricing
View Details
Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO
AP96379 50 µg

Recombinant Human CXCR7/ACKR3 Protein, N-His-SUMO

Sign In for Pricing
View Details