Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sox10 Peptide - N-terminal region

Sox10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dom, Sox21

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sox10 Rabbit Polyclonal Antibody (orb576361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_128139

Preservative

Lyophilized powder

AA Sequence

MLWESKGLHIQTSRTGSPFQGEEEPFMEPSAAAQSVSAVQPGCLVVRIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CTA Rabbit Monoclonal Antibody
MA2061-.05 50 µL

Anti-CTA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Paired Mesoderm Homeobox Protein 1 (PRRX1) Antibody
abx433188 200 µL

Paired Mesoderm Homeobox Protein 1 (PRRX1) Antibody

Sign In for Pricing
View Details
VCL siRNA Oligos set (Human)
49445171 3x 5 nmol

VCL siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human Tumor Biomarker Premixed Kit Luminex Performance Assay
FCSTM25-18 1 Kit

Human Tumor Biomarker Premixed Kit Luminex Performance Assay

Sign In for Pricing
View Details
Mouse EDN1 (Endothelin 1) ELISA Kit
MBS8801398-01 48 Well

Mouse EDN1 (Endothelin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse EDN1 (Endothelin 1) ELISA Kit
MBS8801398-02 96 Well

Mouse EDN1 (Endothelin 1) ELISA Kit

Sign In for Pricing
View Details