Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sox10 Peptide - N-terminal region

Sox10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dom, Sox21

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sox10 Rabbit Polyclonal Antibody (orb576361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_128139

Preservative

Lyophilized powder

AA Sequence

MLWESKGLHIQTSRTGSPFQGEEEPFMEPSAAAQSVSAVQPGCLVVRIQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCAM Protein (Val 24-Gly 559) [His]
VAng-2537Lsx-1mg 1 mg

Human MCAM Protein (Val 24-Gly 559) [His]

Sign In for Pricing
View Details
Dynlt3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6268303 1.0 µg DNA

Dynlt3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Mouse Serpin D1 Protein
orb2994388-01 10 µg

Recombinant Mouse Serpin D1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Serpin D1 Protein
orb2994388-02 50 µg

Recombinant Mouse Serpin D1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Serpin D1 Protein
orb2994388-03 500 µg

Recombinant Mouse Serpin D1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Serpin D1 Protein
orb2994388-04 1 mg

Recombinant Mouse Serpin D1 Protein

Sign In for Pricing
View Details