Fam172a Peptide - N-terminal region
Fam172a Peptide - N-terminal region
Product Specifications
Product Name Alternative
53-E6, pEN87, AF064782, 1110033M05Rik, 2610318O14Rik, 9430037D06Rik
UniProt
Q3TNH5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fam172a Rabbit Polyclonal Antibody (orb576365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAH57380
Preservative
Lyophilized powder
AA Sequence
NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740050-100 1x 100 µL
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740689-500 1x 500 µL
Cytokeratin 8 (K8.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880914-100 1x 100 µL
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details