1110059E24Rik Peptide - N-terminal region
1110059E24Rik Peptide - N-terminal region
Product Specifications
UniProt
Q9CQ90
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with 1110059E24Rik Rabbit Polyclonal Antibody (orb325861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079699
Preservative
Lyophilized powder
AA Sequence
KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940270-100 1x 100 µL
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942337-100 1x 100 µL
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details