Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

1110067D22Rik Peptide - middle region

1110067D22Rik Peptide - middle region

Product Specifications

Product Name Alternative

Grpa, Hspc159, Lgalsla, A530071M23, RP23-455B19.1, 1110067D22Rik

UniProt

Q8VED9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lgalsl Rabbit Polyclonal Antibody (orb325952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776113

Preservative

Lyophilized powder

AA Sequence

CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDYE2 (NM_001031618) Human Over-expression Lysate
LC422215 20 µg

SPDYE2 (NM_001031618) Human Over-expression Lysate

Sign In for Pricing
View Details
Dithiocarbonic Acid S,S'-Diethyl Ester
TRC-D493180-500MG 500 mg

Dithiocarbonic Acid S,S'-Diethyl Ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS809262 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
RMP Antibody
8C18450-AAT 50 µg

RMP Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details