Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

1110067D22Rik Peptide - middle region

1110067D22Rik Peptide - middle region

Product Specifications

Product Name Alternative

Grpa, Hspc159, Lgalsla, A530071M23, RP23-455B19.1, 1110067D22Rik

UniProt

Q8VED9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lgalsl Rabbit Polyclonal Antibody (orb325952) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776113

Preservative

Lyophilized powder

AA Sequence

CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MT-45 Hydrochloride
TRC-M755550-50MG 50 mg

MT-45 Hydrochloride

Sign In for Pricing
View Details
KIAA1239 (NWD2) Human qPCR Primer Pair (NM_001144990)
HP233885 200 Reactions

KIAA1239 (NWD2) Human qPCR Primer Pair (NM_001144990)

Sign In for Pricing
View Details
Lamin A (Ab-22) Antibody
8B8464-AAT 50 µg

Lamin A (Ab-22) Antibody

Sign In for Pricing
View Details
Fmoc-Ser (t-Bu) Wang Resin LL
HLL0751501323.25G 25 g

Fmoc-Ser (t-Bu) Wang Resin LL

Sign In for Pricing
View Details
C12orf76 (NM_207435) Human Over-expression Lysate
LY404032 100 µg

C12orf76 (NM_207435) Human Over-expression Lysate

Sign In for Pricing
View Details
HPDL Rabbit Monoclonal Antibody [Clone ID: R08-5K5]
TA422067 100 µL

HPDL Rabbit Monoclonal Antibody [Clone ID: R08-5K5]

Sign In for Pricing
View Details