4933408B17Rik Peptide - C-terminal region
4933408B17Rik Peptide - C-terminal region
Product Specifications
UniProt
Q8CDF1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Brd8dc Rabbit Polyclonal Antibody (orb324818) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_808441
Preservative
Lyophilized powder
AA Sequence
MDLTTLKRNLSKGRIHTMAEFQRDLMLMFQNAVMYNDSDHHIYHMAVEMQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740158-100 1x 100 µL
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042848-100 1x 100 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details