5730409E04Rik Peptide - C-terminal region
5730409E04Rik Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI849033, 7530403E16Rik
UniProt
Q8BP99
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with 5730409E04Rik Rabbit Polyclonal Antibody (orb325805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013777
Preservative
Lyophilized powder
AA Sequence
RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940050-100 1x 100 µL
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881714-500 1x 500 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471830-100 1x 100 µL
CD68 (Macrophage Marker) (LAMP4/1830), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942344-500 1x 500 µL
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 