Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A730011L01Rik Peptide - middle region

A730011L01Rik Peptide - middle region

Product Specifications

Product Name Alternative

Endov, A730011L01Rik

UniProt

Q8C9A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endov Rabbit Polyclonal Antibody (orb326022) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158108

Preservative

Lyophilized powder

AA Sequence

VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pongo abelii Extended synaptotagmin-1 (ESYT1), partial
MBS7086422 Inquire

Recombinant Pongo abelii Extended synaptotagmin-1 (ESYT1), partial

Sign In for Pricing
View Details
GABRA4 ELISA Kit (Mouse) (OKCA01672)
OKCA01672 96 Well

GABRA4 ELISA Kit (Mouse) (OKCA01672)

Sign In for Pricing
View Details
PD-L1 Polyclonal Antibody, Cy5.5 Conjugated
bs-4941R-Cy5.5 100 µL

PD-L1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
NPR3 Antibody, Biotin conjugated
A29957-50UG 50 µg

NPR3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DT MicroLoops - Medium Aperture Assortment
M5-L18SP-A4 20 Pieces

DT MicroLoops - Medium Aperture Assortment

Sign In for Pricing
View Details
Lentiviral mouse Ttll2 shRNA (UAS) - Lentiviral mouse Ttll2 shRNA (UAS, iRFP) (25)
GTR15229814 1 Vial

Lentiviral mouse Ttll2 shRNA (UAS) - Lentiviral mouse Ttll2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details