A830053O21Rik Peptide - middle region
A830053O21Rik Peptide - middle region
Product Specifications
Product Name Alternative
A830053O21Rik, RP23-343C18.1
UniProt
Q5RJB0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with A830053O21Rik Rabbit Polyclonal Antibody (orb324720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_796156
Preservative
Lyophilized powder
AA Sequence
RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941855-500 1x 500 µL
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681993-100 1x 100 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680872-100 1x 100 µL
Retinol Binding Protein-1 (RBP/872), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details