Aadacl1 Peptide - middle region
Aadacl1 Peptide - middle region
Product Specifications
Product Name Alternative
Aadacl1, B230106I24Rik, CPO-BP, Nceh
UniProt
Q8BLF1
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aadacl1 Rabbit Polyclonal Antibody (orb325487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_848887
Preservative
Lyophilized powder
AA Sequence
LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![N-[5-Chloro-2- (1H-1,2,4-triazol-1-yl) phenyl]-2-{[1- (2,3-dihydro-1,4-benzodioxin-6-yl) -2-methylpropyl]amino}acetamide](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
QMB85953-01 50 mg
N-[5-Chloro-2- (1H-1,2,4-triazol-1-yl) phenyl]-2-{[1- (2,3-dihydro-1,4-benzodioxin-6-yl) -2-methylpropyl]amino}acetamide
Sign In for Pricing
View Details QMB85953-02 0.5 g
N-[5-Chloro-2- (1H-1,2,4-triazol-1-yl) phenyl]-2-{[1- (2,3-dihydro-1,4-benzodioxin-6-yl) -2-methylpropyl]amino}acetamide
Sign In for Pricing
View Details 
MBS1158551-01 0.02 mg (E-Coli)
Recombinant Lymnaea stagnalis Guanine nucleotide-binding protein G (s) subunit alpha
Sign In for Pricing
View Details