Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aadacl1 Peptide - middle region

Aadacl1 Peptide - middle region

Product Specifications

Product Name Alternative

Aadacl1, B230106I24Rik, CPO-BP, Nceh

UniProt

Q8BLF1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aadacl1 Rabbit Polyclonal Antibody (orb325487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848887

Preservative

Lyophilized powder

AA Sequence

LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cycs sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3706403 1.0 µg DNA

Cycs sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cyp4a8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV677924 1.0 µg DNA

Cyp4a8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide
OR1066766-01 25 mg

(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide

Sign In for Pricing
View Details
(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide
OR1066766-02 50 mg

(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide

Sign In for Pricing
View Details
(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide
OR1066766-03 100 mg

(R) -3- (1- (1-Acryloylpiperidin-3-yl) -4-amino-1H-pyrazolo[3,4-d]pyrimidin-3-yl) -N- (4-isopropyl-3-methylphenyl) benzamide

Sign In for Pricing
View Details
Human LAMa5 (Laminin Alpha 5) Microsample ELISA Kit
orb2998534-01 48 Tests

Human LAMa5 (Laminin Alpha 5) Microsample ELISA Kit

Sign In for Pricing
View Details