Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AADACL3 Peptide - C-terminal region

AADACL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-474O21.3

UniProt

Q5VUY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AADACL3 Rabbit Polyclonal Antibody (orb585540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096640

Preservative

Lyophilized powder

AA Sequence

YRKWLGPENIPERFKERGYQLKPHEPMNEAAYLEVSVVLDVMCSPLIAED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPANXB1 (NM_032461) Human Recombinant Protein
TP321009L 1 mg

SPANXB1 (NM_032461) Human Recombinant Protein

Sign In for Pricing
View Details
LAMC2 Recombinant Rabbit monoclonal Antibody
HA751148 100 µL

LAMC2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A2]
TA804325BM 100 µL

XLF (NHEJ1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A2]

Sign In for Pricing
View Details
NF-κB p105/p50 (Ab-923) Antibody
8B0524-AAT 50 µg

NF-κB p105/p50 (Ab-923) Antibody

Sign In for Pricing
View Details
N WASP (WASL) Mouse Monoclonal Antibody [Clone ID: OTI2H5]
CF811282 100 µg

N WASP (WASL) Mouse Monoclonal Antibody [Clone ID: OTI2H5]

Sign In for Pricing
View Details
CHRNA6 Human Gene Knockout Kit (CRISPR)
KN204868BN 1 Kit

CHRNA6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details